BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase placental-like
LigandBDBM50252093
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS activators of Mouse Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase
EC50 12000±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS activators of Mouse Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkaline phosphatase placental-like
Name:Alkaline phosphatase placental-like
Synonyms:placental-like alkaline phosphatase preproprotein
Type:PROTEIN
Mol. Mass.:57374.31
Organism:Homo sapiens (Human)
Description:ChEMBL_29964
Residue:532
Sequence:
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50252093
NameBDBM50252093
Synonyms:6-hydroxybenzo[d][1,3]oxathiol-2-one | CHEMBL442687 | cid_72139
TypeSmall organic molecule
Emp. Form.C7H4O3S
Mol. Mass.168.17
SMILESOc1ccc2sc(=O)oc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a