BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase placental-like
LigandBDBM53236
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS activators of Human Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase
EC50 13500±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS activators of Human Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkaline phosphatase placental-like
Name:Alkaline phosphatase placental-like
Synonyms:placental-like alkaline phosphatase preproprotein
Type:PROTEIN
Mol. Mass.:57374.31
Organism:Homo sapiens (Human)
Description:ChEMBL_29964
Residue:532
Sequence:
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM53236
NameBDBM53236
Synonyms:4-(3-methyl-1-piperidinyl)-N'-(2-methyl-[1,2,4]triazolo[1,5-c]quinazolin-5-yl)-4-oxobutanehydrazide | 4-(3-methylpiperidin-1-yl)-N'-(2-methyl-[1,2,4]triazolo[1,5-c]quinazolin-5-yl)-4-oxidanylidene-butanehydrazide | 4-(3-methylpiperidin-1-yl)-N'-(2-methyl-[1,2,4]triazolo[1,5-c]quinazolin-5-yl)-4-oxobutanehydrazide | 4-keto-4-(3-methylpiperidino)-N'-(2-methyl-[1,2,4]triazolo[1,5-c]quinazolin-5-yl)butyrohydrazide | MLS000924775 | SMR000623667 | cid_24789604
TypeSmall organic molecule
Emp. Form.C20H25N7O2
Mol. Mass.395.4582
SMILESCC1CCCN(C1)C(=O)CCC(=O)NNc1nc2ccccc2c2nc(C)nn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a