BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase placental-like
LigandBDBM75668
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS activators of Human Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase
EC50 12000±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS activators of Human Intestinal Alkaline Phosphatase using Placental Alkaline Phosphatase PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkaline phosphatase placental-like
Name:Alkaline phosphatase placental-like
Synonyms:placental-like alkaline phosphatase preproprotein
Type:PROTEIN
Mol. Mass.:57374.31
Organism:Homo sapiens (Human)
Description:ChEMBL_29964
Residue:532
Sequence:
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM75668
NameBDBM75668
Synonyms:1-N',6-N'-bis(2-phenoxyacetyl)hexanedihydrazide | MLS001219965 | N1',N6'-bis(1-oxo-2-phenoxyethyl)hexanedihydrazide | N1',N6'-bis(2-phenoxyacetyl)adipohydrazide | N1',N6'-bis(2-phenoxyethanoyl)hexanedihydrazide | SMR000608010 | The compound has not trivial name. | cid_3113773
TypeSmall organic molecule
Emp. Form.C22H26N4O6
Mol. Mass.442.465
SMILESO=C(CCCCC(=O)NNC(=O)COc1ccccc1)NNC(=O)COc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a