BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetubiquitin-conjugating enzyme E2 N
LigandBDBM79172
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay
IC50>20000±0 nM
Citation PubChem, PC Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ubiquitin-conjugating enzyme E2 N
Name:Ubiquitin-conjugating enzyme E2 N
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:17137.61
Organism:Homo sapiens (Human)
Description:EBI_101440
Residue:152
Sequence:
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79172
NameBDBM79172
Synonyms:2-[4-[(3Z)-3-[2-(trifluoromethyl)-9-thioxanthenylidene]propyl]-1-piperazinyl]ethanol;hydrochloride | 2-[4-[(3Z)-3-[2-(trifluoromethyl)thioxanthen-9-ylidene]propyl]piperazin-1-yl]ethanol;hydrochloride | 2-[4-[(3Z)-3-[2-(trifluoromethyl)thioxanthen-9-ylidene]propyl]piperazino]ethanol;hydrochloride | Fluphenthixol | MLS001332581 | SMR000875208 | cid_10140115 | cis-(Z)-Flupenthixol dihydrochloride
TypeSmall organic molecule
Emp. Form.C23H25F3N2OS
Mol. Mass.434.518
SMILESOCCN1CCN(CC\C=C2\c3ccccc3Sc3ccc(cc23)C(F)(F)F)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a