BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetX-box-binding protein 1
LigandBDBM67779
Substrate/Competitorn/a
Meas. Tech.XBP1 DR counterscreen for CHOP
IC50 10000±n/a nM
Citation PubChem, PC XBP1 DR counterscreen for CHOP PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
X-box-binding protein 1
Name:X-box-binding protein 1
Synonyms:XBP1
Type:Enzyme Catalytic Domain
Mol. Mass.:28704.14
Organism:Homo sapiens (Human)
Description:gi_47678753
Residue:261
Sequence:
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK
RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQL
SPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVP
YQPPFLCQWGRHQPSWKPLMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67779
NameBDBM67779
Synonyms:(6Z)-4-chloranyl-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one | (6Z)-4-chloro-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)-1-cyclohexa-2,4-dienone | (6Z)-4-chloro-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one | (6Z)-4-chloro-6-(5-phenyl-3-pyrazolin-3-ylidene)cyclohexa-2,4-dien-1-one | MLS000114270 | SMR000091684 | cid_5339816
TypeSmall organic molecule
Emp. Form.C15H11ClN2O
Mol. Mass.270.714
SMILESOc1ccc(Cl)cc1-c1cc([nH]n1)-c1ccccc1
Structure
n/a