Target
DNA damage-inducible transcript 3 protein
Ligand
BDBM67779
Substrate
n/a
Meas. Tech.
CHOP dose-response primary assay
IC50
4780±n/a nM
Citation
 PubChem, PC CHOP dose-response primary assay PubChem Bioassay (2011)[AID]
Target
Name:
DNA damage-inducible transcript 3 protein
Synonyms:
n/a
Type:
Enzyme Catalytic Domain
Mol. Mass.:
19175.17
Organism:
Mus musculus
Description:
gi_160707929
Residue:
168
Sequence:
MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
  
Inhibitor
Name:
BDBM67779
Synonyms:
(6Z)-4-chloranyl-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one | (6Z)-4-chloro-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)-1-cyclohexa-2,4-dienone | (6Z)-4-chloro-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one | (6Z)-4-chloro-6-(5-phenyl-3-pyrazolin-3-ylidene)cyclohexa-2,4-dien-1-one | MLS000114270 | SMR000091684 | cid_5339816
Type:
Small organic molecule
Emp. Form.:
C15H11ClN2O
Mol. Mass.:
270.714
SMILES:
Oc1ccc(Cl)cc1-c1cc([nH]n1)-c1ccccc1
Structure:
Search PDB for entries with ligand similarity: