Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIF-PH2
LigandBDBM109467
Substrate/Competitorn/a
Meas. Tech.HIF-PH Assay
pH7.4±n/a
IC50 87900±n/a nM
Commentsextracted
Citation Ng, DArend, MPFlippin, LA Naphthyridine derivatives as inhibitors of Hypoxia inducible factor (HIF) hydroxylase US Patent US9695170 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
HIF-PH2
Name:Hypoxia-inducible factor prolyl hydroxylase
Synonyms:Egl nine homolog 1 (EGLIN1) | Egl nine homolog 1 (EGLN1) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIFPH2) | Prolyl hydroxylase domain-containing protein 2 (PHD2)
Type:Protein
Mol. Mass.:46035.59
Organism:Homo sapiens (Human)
Description:Q9GZT9
Residue:426
Sequence:
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP
AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL
VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF
DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS
VGKDVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM109467
NameBDBM109467
Synonyms:US9695170 142
TypeSmall Organic Molecule
Emp. Form.C27H25N3O5
Mol. Mass.471.5045
SMILESCC(CC(O)=O)NC(=O)c1ncc2n(Cc3ccccc3)c(=O)c(Cc3ccccc3)cc2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a