BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHexokinase type I
LigandBDBM34648
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of activators of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay
EC50 39900±n/a nM
Citation PubChem, PC Dose Response confirmation of activators of hexokinase domain containing I (HKDC1) in the hexokinase 1 selectivity assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hexokinase type I
Name:Hexokinase type I
Synonyms:Brain form hexokinase | HK I | Hexokinase-1 | hexokinase-1 isoform HKI
Type:PROTEIN
Mol. Mass.:102488.34
Organism:Homo sapiens (Human)
Description:EBI_11382
Residue:917
Sequence:
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34648
NameBDBM34648
Synonyms:(4-chlorodithiazol-5-ylidene)-(4,6-dimethyl-2-pyridyl)amine | 4-chloranyl-N-(4,6-dimethylpyridin-2-yl)-1,2,3-dithiazol-5-imine | 4-chloro-N-(4,6-dimethyl-2-pyridinyl)-5-dithiazolimine | 4-chloro-N-(4,6-dimethylpyridin-2-yl)dithiazol-5-imine | MLS000104333 | SMR000054268 | cid_757789
TypeSmall organic molecule
Emp. Form.C9H8ClN3S2
Mol. Mass.257.763
SMILESCc1cc(C)nc(c1)N=c1ssnc1Cl |w:8.8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a