Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 4
LigandBDBM81430
Substrate/Competitorn/a
Meas. Tech.In Vitro Kinase Assay
Ki 9.1±2.9 nM
Citation Wang, SGriffiths, GMidgley, CABarnett, ALCooper, MGrabarek, JIngram, LJackson, WKontopidis, GMcClue, SJMcInnes, CMcLachlan, JMeades, CMezna, MStuart, IThomas, MPZheleva, DILane, DPJackson, RCGlover, DMBlake, DGFischer, PM Discovery and characterization of 2-anilino-4- (thiazol-5-yl)pyrimidine transcriptional CDK inhibitors as anticancer agents. Chem Biol17:1111-21 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 4
Name:Cyclin-dependent kinase 4
Synonyms:CDK4 | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3
Type:Enzyme Subunit
Mol. Mass.:33731.96
Organism:Homo sapiens (Human)
Description:P11802
Residue:303
Sequence:
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81430
NameBDBM81430
Synonyms:CDK Inhibitor, 3
TypeSmall organic molecule
Emp. Form.C15H16N6O2S2
Mol. Mass.376.457
SMILESCNc1nc(C)c(s1)-c1ccnc(Nc2cccc(c2)S(N)(=O)=O)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a