Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD1
LigandBDBM50001955
Substrate/Competitorn/a
Ki 8±n/a nM
CommentsPDSP_324
Citation Burt, DRCreese, ISnyder, SH Properties of [3H]haloperidol and [3H]dopamine binding associated with dopamine receptors in calf brain membranes. Mol Pharmacol12:800-12 (1976) [PubMed]
More Info.:Get all data from this article
 
DRD1
Name:Dopamine receptor
Synonyms:D(1A) dopamine receptor | DOPAMINE D1
Type:Enzyme Catalytic Domain
Mol. Mass.:49330.65
Organism:BOVINE
Description:DOPAMINE D1 DRD1 BOVINE::Q95136
Residue:446
Sequence:
MRTLNTSTMEGTGLVAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTGPSEGNATSLG
KTINNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN
CQTTTGNGNPMECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS
GETKPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNVVYLIPHAVGSSEGLKKEEAVGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001955
NameBDBM50001955
Synonyms:(-)6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol(APO) | (Apomorphine) 6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol | (R)-6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol ((R)-apomorphine) | (R)-6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol (apomorphine) | (R)-6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol(apomorphine) | (apomorphine)6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol | 6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol | 6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol ((R)-apomorphine) | 6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol((R)-apomorphine) | APOKYN | APOMORPHINE | APOMORPHINE HYDROCHLORIDE | APOMORPHINE6-Methyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol | CHEMBL53
TypeSmall organic molecule
Emp. Form.C17H17NO2
Mol. Mass.267.3224
SMILESCN1CCc2cccc-3c2[C@H]1Cc1ccc(O)c(O)c-31 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a