Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM67544
Substrate/Competitorn/a
Ki 2.1±n/a nM
CommentsPDSP_2800
Citation Burt, DRCreese, ISnyder, SH Properties of [3H]haloperidol and [3H]dopamine binding associated with dopamine receptors in calf brain membranes. Mol Pharmacol12:800-12 (1976) [PubMed]
More Info.:Get all data from this article
 
DRD2
Name:Dopamine receptor
Synonyms:DOPAMINE D2 | Dopamine D2 receptor | Dopamine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:50698.79
Organism:BOVINE
Description:DOPAMINE D2 DRD2 BOVINE::P20288
Residue:444
Sequence:
MDPLNLSWYDDDPESRNWSRPFNGSEGKADRPPYNYYAMLLTLLIFVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKTVNPKIAKIFEIQSMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67544
NameBDBM67544
Synonyms:N,N-dimethyl-3-[2-(trifluoromethyl)-10-phenothiazinyl]-1-propanamine;hydrochloride | N,N-dimethyl-3-[2-(trifluoromethyl)phenothiazin-10-yl]propan-1-amine;hydrochloride | SR-01000000224-4 | TRIFLUPROMAZINE | cid_66069 | dimethyl-[3-[2-(trifluoromethyl)phenothiazin-10-yl]propyl]amine;hydrochloride
TypeSmall organic molecule
Emp. Form.C18H19F3N2S
Mol. Mass.352.417
SMILESCN(C)CCCN1c2ccccc2Sc2ccc(cc12)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a