Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene 2
LigandBDBM50013889
Substrate/Competitorn/a
Ki 93±n/a nM
CommentsPDSP_1103
Citation Jackson, RHMorrissey, MMSills, MAJarvis, MF Comparison of antagonist and agonist binding to the leukotriene B4 receptor intact human polymorphonuclear neutrophils (PMN). J Pharmacol Exp Ther262:80-9 (1992) [PubMed]
More Info.:Get all data from this article
 
Leukotriene 2
Name:Leukotriene B4 receptor
Synonyms:LTB4 receptor JULF2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2
Type:Enzyme Catalytic Domain
Mol. Mass.:41553.59
Organism:Homo sapiens (Human)
Description:Leukotriene 2 0 HUMAN::Q9NPC1
Residue:389
Sequence:
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL
AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL
GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA
LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR
GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA
RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT
TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013889
NameBDBM50013889
Synonyms:(5S,6Z,8E,10E,12R,14Z)-5,12-dihydroxyicosa-6,8,10,14-tetraenoic acid | (S-(R*,S*-(E,Z,E,Z)))-5,12-Dihydroxy-6,8,10,14-eicosatetraenoic acid | 5,12-Dihete | 5,12-Hete | 5S,12R-dihydroxy-6Z,8E,10E,14Z-eicosatetraenoic acid | CHEMBL65061 | DIHETE 12(s), 5(s) | LTB4 | leukotriene B4
TypeSmall organic molecule
Emp. Form.C20H32O4
Mol. Mass.336.4657
SMILESCCCCC\C=C/C[C@@H](O)\C=C\C=C\C=C/[C@@H](O)CCCC(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a