Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-C
LigandBDBM81552
Substrate/Competitorn/a
Meas. Tech.Biochemical Assay
IC50 41±0.0 nM
Citation Miduturu, CVDeng, XKwiatkowski, NYang, WBrault, LFilippakopoulos, PChung, EYang, QSchwaller, JKnapp, SKing, RWLee, JDHerrgard, SZarrinkar, PGray, NS High-throughput kinase profiling: a more efficient approach toward the discovery of new kinase inhibitors. Chem Biol18:868-79 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Aurora-C
Name:Serine/threonine-protein kinase Aurora-C
Synonyms:Aurora kinase C | Aurora kinase C (AURKC) | Aurora-C | Aurora/Ipl1-related kinase 3 | Aurora/Ipl1/Eg2 protein 2 | Serine/threonine-protein kinase 13
Type:Enzyme
Mol. Mass.:35602.43
Organism:Homo sapiens (Human)
Description:Amino acid residues 1-309 were expressed as His-tagged fusion protein using baculovirus expression system.
Residue:309
Sequence:
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81552
NameBDBM81552
Synonyms:Benzo[e]pyrimido[5,4-b][1,4]diazepin-6(11H)-one, 1 | Scaffold, B54
TypeSmall organic molecule
Emp. Form.C24H26N6O2
Mol. Mass.430.5022
SMILESCN1c2ccccc2C(=O)N(C)c2cnc(Nc3ccc(cc3)N3CCC(O)CC3)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a