Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTubulin
LigandBDBM81743
Substrate/Competitorn/a
Meas. Tech.In Vitro Activity Assay
IC50>4.0e+4± 0 nM
Citation Morgan, REAhn, SNzimiro, SFotie, JPhelps, MACotrill, JYakovich, AJSackett, DLDalton, JTWerbovetz, KA Inhibitors of tubulin assembly identified through screening a compound library. Chem Biol Drug Des72:513-24 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tubulin
Name:Tubulin
Synonyms:Alpha-tubulin
Type:Protein
Mol. Mass.:49756.63
Organism:Leishmania tarentolae (Sauroleishmania tarentolae)
Description:Q1A5Y2
Residue:451
Sequence:
MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGVEDDAFNTFFSETGAGK
HVPRCLFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANNYARGHYTIGKEIVDLALD
RIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVDYGKKSKLGYTVYPSPQVSTA
VVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLDIERPSYTNVNRLIGQVVSSLTA
SLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVVSAEKAYHEQLSVSDITNSVFEPAG
MLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPP
TVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGAESADDMGEEDVEEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81743
NameBDBM81743
Synonyms:Oryzalin, 1
TypeSmall organic molecule
Emp. Form.C12H18N4O6S
Mol. Mass.346.36
SMILESCCCN(CCC)c1c(cc(cc1N(=O)=O)S(N)(=O)=O)N(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a