Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEGF
LigandBDBM50010685
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_664
Citation Mottola, DMBrewster, WKCook, LLNichols, DEMailman, RB Dihydrexidine, a novel full efficacy D1 dopamine receptor agonist. J Pharmacol Exp Ther262:383-93 (1992) [PubMed]
More Info.:Get all data from this article
 
EGF
Name:EGF
Synonyms:Pro-epidermal growth factor
Type:Enzyme Catalytic Domain
Mol. Mass.:124115.09
Organism:RAT
Description:P07522
Residue:1133
Sequence:
MLFSLTFLSVFLKITVLSVTAQQTRNCQSGPLERSGTTTYAAAGPPRFLIFLQGNSIFRI
NTDGTNHQQLVVDAGVSVVMDFHYKEERLYWVDLERQLLQRVFFNGSGQETVCKVDKNVS
GLAINWIDGEILRTDRWKGVITVTDMNGNNSRVLLSSLKRPANILVDPTERLIFWSSVVT
GNLHRADLGGMDVKTLLEAPERISVLILDILDKRLFWAQDGREGSHGYIHSCDYNGGSIH
HIRHQARHDLLTMAIFGDKILYSALKEKAIWIADKHTGKNVVRVNLDPASVPPRELRVVH
LHAQPGTENRAQASDSERCKQRRGQCLYSLSERDPNSDSSACAEGYTLSRDRKYCEDVNE
CALQNHGCTLGCENIPGSYYCTCPTGFVLLPDGKRCHELVACPGNRSECSHDCILTSDGP
LCICPAGSVLGKDGKTCTGCSFSDNGGCSQICLPLSLASWECDCFPGYDLQLDRKSCAAS
MGPQPFLLFANSQDIRHMHFDGTDYKTLLSRQMGMVFALDYDPVESKIYFAQTALKWIER
ANLDGSQRERRITEGVDTPEGLAVDWIGRRIYWTDSGKSVIEGSDLSGKHHQIIIKESIS
RPRGIAVHPKARRLFWTDTGMSPRIESSSLQGSDRTLIASSNLLEPSGIAIDYLTDTLYW
CDTKLSVIEMADLDGSKRRRLTQNDVGHPFSLAVFEDHVWFSDWAIPSVIRVNKRTGQNR
VRLRGSMLKPSSLVVVHPLAKPGADPCLHRNGGCEHICQESLGTAQCLCREGFVKAPDGK
MCLTRKDDQILAGDNADLSKEVASLDNSPKAYVPDDDRTESSTLVAEIMVSGLNYEDDCG
PGGCGSHAHCISEGEAAVCQCLKGFAGDGNLCSDIDECELGSSDCPPTSSRCINTEGGYV
CQCSEGYEGDGIYCLDVDECQQGSHGCSENATCTNTEGGYNCTCAGCPSAPGLPCPDSTS
PSLLGKDGCHWVRNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDL
RWWKLRHADYGQRHDITVVSVCVVALALLLLLGMWGTYYYRTRKQLSESSKKPSEESSSN
VSSNGPDSSGAGVSSGPQPWFVVLEEHQQPKNGRLPAAGTNGAVVEAGLSSSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010685
NameBDBM50010685
Synonyms:(+/-)-trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine | (6aR,12bR)-5,6,6a,7,8,12b-Hexahydro-benzo[a]phenanthridine-10,11-diol | 5,6,6a,7,8,12b-Hexahydro-benzo[a]phenanthridine-10,11-diol | CHEMBL43345 | Dihydrexidine, DHX
TypeSmall organic molecule
Emp. Form.C17H17NO2
Mol. Mass.267.3224
SMILESOc1cc2CC[C@H]3NCc4ccccc4[C@H]3c2cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a