Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
LigandBDBM50010685
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_664
Citation Mottola, DMBrewster, WKCook, LLNichols, DEMailman, RB Dihydrexidine, a novel full efficacy D1 dopamine receptor agonist. J Pharmacol Exp Ther262:383-93 (1992) [PubMed]
More Info.:Get all data from this article
 
Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
Name:Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
Synonyms:Benzodiazepine receptors | GABA A Alpha1Beta2Gamma2 | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | Gamma-aminobutyric acid receptor subunit alpha-1 | TBPS
Type:Enzyme
Mol. Mass.:51770.21
Organism:Rattus norvegicus (Rat)
Description:P62813
Residue:455
Sequence:
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010685
NameBDBM50010685
Synonyms:(+/-)-trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine | (6aR,12bR)-5,6,6a,7,8,12b-Hexahydro-benzo[a]phenanthridine-10,11-diol | 5,6,6a,7,8,12b-Hexahydro-benzo[a]phenanthridine-10,11-diol | CHEMBL43345 | Dihydrexidine, DHX
TypeSmall organic molecule
Emp. Form.C17H17NO2
Mol. Mass.267.3224
SMILESOc1cc2CC[C@H]3NCc4ccccc4[C@H]3c2cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a