Reaction Details |
 | Report a problem with these data |
Target | ADRA2C |
---|
Ligand | BDBM50013515 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.19±n/a nM |
---|
Comments | PDSP_1987 |
---|
Citation | Bylund, DB; Blaxall, HS; Iversen, LJ; Caron, MG; Lefkowitz, RJ; Lomasney, JW Pharmacological characteristics of alpha 2-adrenergic receptors: comparison of pharmacologically defined subtypes with subtypes identified by molecular cloning. Mol Pharmacol42:1-5 (1992) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
ADRA2C |
---|
Name: | ADRA2C |
Synonyms: | adrenergic Alpha2C |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 27257.01 |
Organism: | OK |
Description: | adrenergic Alpha2C ADRA2C OK::G3GWB4 |
Residue: | 230 |
Sequence: | MAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIV
AVWLISAVISFPPLVSFYRRSDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARI
YRFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREAC
QLPEPLFKFFFWIGYCKSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
|
|
|
BDBM50013515 |
---|
Name | BDBM50013515 |
Synonyms: | (+)-yohimbine | (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylic acid methyl ester | 17alpha-hydroxyyohimban-16alpha-carboxylic acid methyl ester | CHEMBL15245 | CORYNANTHINE | Johimbin | Quebrachin | RAUWOLSCINE | YOHIMBINE CHLORIDE | Yohimbin | Yohimbine | aphrodine | cid_8969 | corynine | methyl 17alpha-hydroxyyohimban-16alpha-carboxylate | quebrachine | yohimbic acid methyl ester |
Type | Small organic molecule |
Emp. Form. | C21H26N2O3 |
Mol. Mass. | 354.4427 |
SMILES | COC(=O)[C@H]1[C@@H](O)CC[C@H]2CN3CCc4c([nH]c5ccccc45)[C@@H]3C[C@H]12 |r| |
Structure |
|
n/a |
---|