Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM81790
Substrate/Competitorn/a
Ki 2.4±n/a nM
CommentsPDSP_287
Citation Sokoloff, PGiros, BMartres, MPAndrieux, MBesancon, RPilon, CBouthenet, MLSouil, ESchwartz, JC Localization and function of the D3 dopamine receptor. Arzneimittelforschung42:224-30 (1992) [PubMed]
More Info.:Get all data from this article
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81790
NameBDBM81790
Synonyms:Amisulpride | CAS_71675-85-9 | NSC_2159 | US10167256, Amisulpride
TypeSmall organic molecule
Emp. Form.C17H27N3O4S
Mol. Mass.369.479
SMILESCCN1CCCC1CNC(=O)c1cc(c(N)cc1OC)S(=O)(=O)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a