Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA A receptor alpha-1/beta-1/gamma-2
LigandBDBM22032
Substrate/Competitorn/a
Ki 5±n/a nM
CommentsPDSP_1506
Citation Awad, MGavish, M Peripheral-type benzodiazepine receptors in human cerebral cortex, kidney, and colon. Life Sci49:1155-61 (1991) [PubMed]
More Info.:Get all data from this article
 
GABA A receptor alpha-1/beta-1/gamma-2
Name:Gamma-aminobutyric acid receptor subunit alpha-1/ beta-1
Synonyms:GABA A Alpha1Beta1Gamma2 | GABA A Alpha1Beta2Gamma2 | GABA A Alpha1Beta3Gamma2 | GABA A Benzodiazepine brain | GABA A Benzodiazepine liver | GABA receptor alpha-1 subunit | GABA(A) receptor subunit alpha-1 | GABA-A | GABA-A receptor | Gamma-aminobutyric acid receptor subunit alpha (GABAA) | Gamma-aminobutyric acid receptor subunit alpha-1 | TBPS | agonist GABA site
Type:Protein
Mol. Mass.:51817.35
Organism:Homo sapiens (Human)
Description:P14867
Residue:456
Sequence:
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22032
NameBDBM22032
Synonyms:1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxamide | CHEMBL15313 | N-(butan-2-yl)-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide | PK 11195 | PK-11195 | PK11195 | RP 52028 | [3H]PK 11195
Typeradiolabeled ligand
Emp. Form.C21H21ClN2O
Mol. Mass.352.857
SMILESCCC(C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a