Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
LigandBDBM22032
Substrate/Competitorn/a
Ki 4±n/a nM
CommentsPDSP_1506
Citation Awad, MGavish, M Peripheral-type benzodiazepine receptors in human cerebral cortex, kidney, and colon. Life Sci49:1155-61 (1991) [PubMed]
More Info.:Get all data from this article
 
Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
Name:Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
Synonyms:Benzodiazepine receptors | GABA A Alpha1Beta2Gamma2 | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | Gamma-aminobutyric acid receptor subunit alpha-1 | TBPS
Type:Enzyme
Mol. Mass.:51770.21
Organism:Rattus norvegicus (Rat)
Description:P62813
Residue:455
Sequence:
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22032
NameBDBM22032
Synonyms:1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxamide | CHEMBL15313 | N-(butan-2-yl)-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide | PK 11195 | PK-11195 | PK11195 | RP 52028 | [3H]PK 11195
Typeradiolabeled ligand
Emp. Form.C21H21ClN2O
Mol. Mass.352.857
SMILESCCC(C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a