Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCCKBR
LigandBDBM81818
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2651
Citation Garritsen, AIjzerman, APTulp, MTCragoe, EJSoudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed]
More Info.:Get all data from this article
 
CCKBR
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin A | Gastrin/cholecystokinin type B receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48980.43
Organism:RAT
Description:Cholecystokinin A CCKBR RAT::P30553
Residue:452
Sequence:
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL
ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV
QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW
RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA
RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81818
NameBDBM81818
Synonyms:CAS_1794 | CHEMBL1909810 | HMA | NSC_1794
TypeSmall organic molecule
Emp. Form.C12H18ClN7O
Mol. Mass.311.771
SMILESNC(=N)NC(=O)c1nc(Cl)c(nc1N)N1CCCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a