Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor 1
LigandBDBM81819
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2652
Citation Garritsen, AIjzerman, APTulp, MTCragoe, EJSoudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed]
More Info.:Get all data from this article
 
Cysteinyl leukotriene receptor 1
Name:Cysteinyl leukotriene receptor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:39007.58
Organism:GUINEA PIG
Description:Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81819
NameBDBM81819
Synonyms:Benzamil | CAS_1937-37-7 | CHEMBL212579 | NSC_108107
TypeSmall organic molecule
Emp. Form.C13H14ClN7O
Mol. Mass.319.75
SMILESNC(NC(=O)c1nc(Cl)c(N)nc1N)=NCc1ccccc1 |w:14.15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a