Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM81818
Substrate/Competitorn/a
Ki 3900±n/a nM
CommentsPDSP_2651
Citation Garritsen, AIjzerman, APTulp, MTCragoe, EJSoudijn, W Receptor binding profiles of amiloride analogues provide no evidence for a link between receptors and the Na+/H+ exchanger, but indicate a common structure on receptor proteins. J Recept Res11:891-907 (1991) [PubMed]
More Info.:Get all data from this article
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:KOR-1 | Kappa Opioid Receptor | OPIATE Kappa
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42692.90
Organism:Rattus norvegicus (rat)
Description:P34975
Residue:380
Sequence:
MESPIQIFRGEPGPTCAPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAVLSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81818
NameBDBM81818
Synonyms:CAS_1794 | CHEMBL1909810 | HMA | NSC_1794
TypeSmall organic molecule
Emp. Form.C12H18ClN7O
Mol. Mass.311.771
SMILESNC(=N)NC(=O)c1nc(Cl)c(nc1N)N1CCCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a