Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPACAP
LigandBDBM81822
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2618
Citation Schäfer, HSchwarzhoff, RCreutzfeldt, WSchmidt, WE Characterization of a guanosine-nucleotide-binding-protein-coupled receptor for pituitary adenylate-cyclase-activating polypeptide on plasma membranes from rat brain. Eur J Biochem202:951-8 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
PACAP
Name:PACAP
Synonyms:PACAP-27 | PACAP-38 | Pituitary adenylate cyclase-activating polypeptide
Type:Enzyme Catalytic Domain
Mol. Mass.:19565.66
Organism:RAT
Description:PACAP 0 RAT::P13589
Residue:175
Sequence:
MTMCSGARLALLVYGIIMHNSVSCSPAAGLSFPGIRPEEEAYDQDGNPLQDFYDWDPPGA
GSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAA
VDDRAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81822
NameBDBM81822
Synonyms:CAS_6804 | GMP | Guanosine | NSC_6804
TypeSmall organic molecule
Emp. Form.C10H14N5O8P
Mol. Mass.363.2206
SMILESNc1nc2n(cnc2c(=O)[nH]1)C1OC(COP(O)(O)=O)C(O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a