Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCCKBR
LigandBDBM50002477
Substrate/Competitorn/a
Ki 25±n/a nM
CommentsPDSP_2195
Citation Lin, CWShiosaki, KMiller, TRWitte, DGBianchi, BRWolfram, CAKopecka, HCraig, RWagenaar, FNadzan, AM Characterization of two novel cholecystokinin tetrapeptide (30-33) analogues, A-71623 and A-70874, that exhibit high potency and selectivity for cholecystokinin-A receptors. Mol Pharmacol39:346-51 (1991) [PubMed]
More Info.:Get all data from this article
 
CCKBR
Name:CCKBR
Synonyms:Cholecystokinin A
Type:Enzyme Catalytic Domain
Mol. Mass.:48683.10
Organism:GUINEA PIG
Description:Cholecystokinin A CCKBR GUINEA PIG::H0VZC5
Residue:450
Sequence:
MELLKLNRSLQGPGPGPGAPLCRPAGPLLNSSGAGNVSCETPRIRGAGTRVKSMAILFNV
TSLLSCWNKYRIIKVLGLSRRLRTVTKAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFG
TVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVILATWLLSG
LLMVPYPVYTAVQPVGPRVLQCVHRWPNARVRQTWSVLLLLLLFFVPGVVMAVAYGLISR
ELYLGLRFDGDADSESQSRVRGPGGLSGSAPGPAHQNGRCRPESGLSGEDSDGCYVQLPR
SRPALELSALAASTPAPGPGPRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRA
FDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLDTCARCCPRPPRARP
RPLPEEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002477
NameBDBM50002477
Synonyms:(S)-3-{(S)-2-[(S)-2-tert-Butoxycarbonylamino-3-(1H-indol-3-yl)-propionylamino]-4-methylsulfanyl-butyrylamino}-N-((S)-1-carbamoyl-2-phenyl-ethyl)-succinamic acid | 3-{1-[1-butyl oxycarbonylamino-2-(1H-3-indolyl)ethylcarboxamido]-3-methylsulfanylpropylcarboxamido}-3-(1-carbamoyl-2-phenylethylcarbamoyl)propanoic acid | 3-{2-[2-tert-Butoxycarbonylamino-3-(1H-indol-3-yl)-propionylamino]-4-methylsulfanyl-butyrylamino}-N-(1-carbamoyl-2-phenyl-ethyl)-succinamic acid | Boc-CCK-4 | CHEMBL64605
TypeSmall organic molecule
Emp. Form.C34H44N6O8S
Mol. Mass.696.814
SMILESCSCC[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)OC(C)(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a