Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM81993
Substrate/Competitorn/a
Ki 672±n/a nM
CommentsPDSP_423
Citation Sunahara, RKGuan, HCO'Dowd, BFSeeman, PLaurier, LGNg, GGeorge, SRTorchia, JVan Tol, HHNiznik, HB Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature350:614-9 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81993
NameBDBM81993
Synonyms:BROMOCRIPTINE | Bromocriptine+ (GTP+) | Bromocriptine+ (GTP-)
Typen/a
Emp. Form.C32H40BrN5O5
Mol. Mass.654.594
SMILESCC(C)C[C@@H]1N2C(=O)[C@](NC(=O)[C@H]3CN(C)[C@@H]4Cc5c(Br)[nH]c6cccc(C4=C3)c56)(O[C@@]2(O)[C@@H]2CCCN2C1=O)C(C)C |r,c:28|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a