Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM50012994
Substrate/Competitorn/a
Ki 645±n/a nM
CommentsPDSP_1729
Citation Sunahara, RKGuan, HCO'Dowd, BFSeeman, PLaurier, LGNg, GGeorge, SRTorchia, JVan Tol, HHNiznik, HB Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature350:614-9 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50012994
NameBDBM50012994
Synonyms:6-Propyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinoline-10,11-diol; hydrochloride | CHEMBL538542 | NPA,(+) | SKF-76783 | cid_11957529
TypeSmall organic molecule
Emp. Form.C19H21NO2
Mol. Mass.295.3755
SMILESCCCN1CCc2cccc-3c2[C@H]1Cc1ccc(O)c(O)c-31
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a