Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D5 receptor
LigandBDBM50028421
Substrate/Competitorn/a
Ki 918±n/a nM
CommentsPDSP_1453
Citation Sunahara, RKGuan, HCO'Dowd, BFSeeman, PLaurier, LGNg, GGeorge, SRTorchia, JVan Tol, HHNiznik, HB Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature350:614-9 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine D5 receptor
Name:Dopamine receptor
Synonyms:D(1B) dopamine receptor | D(5) dopamine receptor | D1beta dopamine receptor | DOPAMINE D5 | DRD5 | Dopamine receptor | dopamine receptor D5
Type:Protein
Mol. Mass.:52943.41
Organism:Homo sapiens (Human)
Description:P21918
Residue:477
Sequence:
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50028421
NameBDBM50028421
Synonyms:9-Methylsulfanylmethyl-7-propyl-4,6,6a,7,8,9,10,10a-octahydro-indolo[4,3-fg]quinoline; compound with methanesulfonic acid | CHEMBL1275 | LY-127809 | PERGOLIDE MESYLATE | Pergolide | Permax
TypeSmall organic molecule
Emp. Form.C19H26N2S
Mol. Mass.314.488
SMILESCCCN1C[C@H](CSC)C[C@H]2[C@H]1Cc1c[nH]c3cccc2c13
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a