Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D5 receptor
LigandBDBM21397
Substrate/Competitorn/a
Ki 4500±n/a nM
CommentsPDSP_1739
Citation Sunahara, RKGuan, HCO'Dowd, BFSeeman, PLaurier, LGNg, GGeorge, SRTorchia, JVan Tol, HHNiznik, HB Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature350:614-9 (1991) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine D5 receptor
Name:Dopamine receptor
Synonyms:D(1B) dopamine receptor | D(5) dopamine receptor | D1beta dopamine receptor | DOPAMINE D5 | DRD5 | Dopamine receptor | dopamine receptor D5
Type:Protein
Mol. Mass.:52943.41
Organism:Homo sapiens (Human)
Description:P21918
Residue:477
Sequence:
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21397
NameBDBM21397
Synonyms:8-[4-(4-fluorophenyl)-4-keto-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxidanylidene-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxobutyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL267930 | MLS000028615 | SMR000058674 | SPIPERONE | Spiroperidol | US9359372, Spiperone | [3H]-Spiroperidol | cid_5265
Typeradiolabeled ligand
Emp. Form.C23H26FN3O2
Mol. Mass.395.4698
SMILESFc1ccc(cc1)C(=O)CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a