Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium release-activated calcium channel
LigandBDBM50035057
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_779
Citation Schipper, JTulp, MTSijbesma, H Neurochemical profile of eltoprazine. Drug Metabol Drug Interact8:85-114 (1990) [PubMed]
More Info.:Get all data from this article
 
Calcium release-activated calcium channel
Name:Calcium release-activated calcium channel
Synonyms:CRACM1 | Calcium channel (VER) | Calcium release-activated calcium channel protein 1 | ORAI1 | Protein orai-1 | TMEM142A | Transmembrane protein 142A
Type:Protein
Mol. Mass.:32676.63
Organism:Homo sapiens (Human)
Description:Q96D31
Residue:301
Sequence:
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50035057
NameBDBM50035057
Synonyms:(eltoprazine)1-(2,3-Dihydro-benzo[1,4]dioxin-5-yl)-piperazine | 1-(2,3-Dihydro-benzo[1,4]dioxin-5-yl)-piperazine | CHEMBL282614 | Eltoprazine
TypeSmall organic molecule
Emp. Form.C12H16N2O2
Mol. Mass.220.2676
SMILESC1CN(CCN1)c1cccc2OCCOc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a