Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50064176
Substrate/Competitorn/a
Ki 50.12±n/a nM
CommentsPDSP_1220
Citation Dörje, FWess, JLambrecht, GTacke, RMutschler, EBrann, MR Antagonist binding profiles of five cloned human muscarinic receptor subtypes. J Pharmacol Exp Ther256:727-33 (1991) [PubMed]
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064176
NameBDBM50064176
Synonyms:CHEMBL27673 | CHEMBL500996 | METHOCTRAMINE | N,N''-Bis-[6-(2-methoxy-benzylamino)-hexyl]-octane-1,8-diamine | N1,N8-bis(6-(2-methoxybenzylamino)hexyl)octane-1,8-diamine
TypeSmall organic molecule
Emp. Form.C36H62N4O2
Mol. Mass.582.9031
SMILESCOc1ccccc1CNCCCCCCNCCCCCCCCNCCCCCCNCc1ccccc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a