Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM81898
Substrate/Competitorn/a
Ki 72.44±n/a nM
CommentsPDSP_2384
Citation Dörje, FWess, JLambrecht, GTacke, RMutschler, EBrann, MR Antagonist binding profiles of five cloned human muscarinic receptor subtypes. J Pharmacol Exp Ther256:727-33 (1991) [PubMed]
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M4
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81898
NameBDBM81898
Synonyms:(R)-Hexbutinol | (S)-Hexbutinol | CAS_2054312 | CAS_2054314 | NSC_2054312 | NSC_2054314
TypeSmall organic molecule
Emp. Form.C21H29NO
Mol. Mass.311.4611
SMILESOC(C#CCN1CCCCC1)(C1CCCCC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a