Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M4
LigandBDBM81900
Substrate/Competitorn/a
Ki 6.46±n/a nM
CommentsPDSP_2387
Citation Dörje, FWess, JLambrecht, GTacke, RMutschler, EBrann, MR Antagonist binding profiles of five cloned human muscarinic receptor subtypes. J Pharmacol Exp Ther256:727-33 (1991) [PubMed]
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M4
Name:Muscarinic acetylcholine receptor M4
Synonyms:CHRM4 | Cholinergic, muscarinic M4 | Muscarinic acetylcholine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53079.31
Organism:Homo sapiens (Human)
Description:Cholinergic, muscarinic M4 CHRM4 HUMAN M3::P08173
Residue:479
Sequence:
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81900
NameBDBM81900
Synonyms:AQ-RA 741 | CAS_129989 | NSC_129989
TypeSmall organic molecule
Emp. Form.C27H37N5O2
Mol. Mass.463.615
SMILESCCN(CC)CCCCC1CCN(CC(=O)N2c3ccccc3C(=O)Nc3cccnc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a