Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCHRM5
LigandBDBM81462
Substrate/Competitorn/a
Ki 5.01±n/a nM
CommentsPDSP_2389
Citation Dörje, FWess, JLambrecht, GTacke, RMutschler, EBrann, MR Antagonist binding profiles of five cloned human muscarinic receptor subtypes. J Pharmacol Exp Ther256:727-33 (1991) [PubMed]
More Info.:Get all data from this article
 
CHRM5
Name:Muscarinic acetylcholine receptor M1/M5 chimeric protein
Synonyms:Muscarinic acetylcholine receptor | Muscarinic acetylcholine receptor M5 | muscarinic acetylcholine receptor M5
Type:PROTEIN
Mol. Mass.:60102.35
Organism:Homo sapiens (Human)
Description:ChEMBL_1517990
Residue:532
Sequence:
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81462
NameBDBM81462
Synonyms:(R)-Trihexyphenidyl | (S)-Trihexyphenidyl | Benzhexol | CAS_58947-95-8 | NSC_5572 | TRIHEXYPHENIDYL HYDROCHLORIDE | Trihexyphenidyl
TypeSmall organic molecule
Emp. Form.C20H31NO
Mol. Mass.301.4662
SMILESOC(CCN1CCCCC1)(C1CCCCC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a