Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM10847
Substrate/Competitorn/a
Ki 5600±n/a nM
CommentsPDSP_2649
Citation Klotz, KNVogt, HTawfik-Schlieper, H Comparison of A1 adenosine receptors in brain from different species by radioligand binding and photoaffinity labelling. Naunyn Schmiedebergs Arch Pharmacol343:196-201 (1991) [PubMed]
More Info.:Get all data from this article
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10847
NameBDBM10847
Synonyms:1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | 1,3-dimethyl-7H-purine-2,6-dione | Afonilum | Aminophyllin | Aminophylline | CHEMBL190 | Cardophyllin | Euphylline | Theophylline | Theophylline (1,3-dimethylxanthine)
TypeSmall organic molecule
Emp. Form.C7H8N4O2
Mol. Mass.180.164
SMILESCn1c2nc[nH]c2c(=O)n(C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a