Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBHE
LigandBDBM50281563
Substrate/Competitorn/a
Ki 30±n/a nM
CommentsPDSP_1488
Citation Burcher, EBuck, SHLovenberg, WO'Donohue, TL Characterization and autoradiographic localization of multiple tachykinin binding sites in gastrointestinal tract and bladder. J Pharmacol Exp Ther236:819-31 (1986) [PubMed]
More Info.:Get all data from this article
 
BHE
Name:BHE
Synonyms:ATP synthase subunit a
Type:Enzyme Catalytic Domain
Mol. Mass.:25083.82
Organism:RAT
Description:P05504
Residue:226
Sequence:
MNENLFASFITPTMMGLPIVVTIIMFPSILFPSSERLISNRLHSFQHWLIKLIIKQMMLI
HTPKGRTWALMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVILGFRHK
LKNSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV
LMDISPPTATITFIILLLLTVLEFAVALIQAYVFTLLVSLYLHDNT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281563
NameBDBM50281563
Synonyms:CHEMBL414786 | pGlu-Ala-Asp-Pro-Asn-Lys-Phe-Tyr-Gly-Leu-Met-NH2 | physalaemin
TypeSmall organic molecule
Emp. Form.C58H84N14O16S
Mol. Mass.1265.437
SMILESCSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)C1CCC(=O)N1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a