Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA A receptor alpha-3/beta-2/gamma-2
LigandBDBM26263
Substrate/Competitorn/a
Ki 0.62±n/a nM
CommentsPDSP_1609
Citation Pritchett, DBLüddens, HSeeburg, PH Type I and type II GABAA-benzodiazepine receptors produced in transfected cells. Science245:1389-92 (1989) [PubMed]
More Info.:Get all data from this article
 
GABA A receptor alpha-3/beta-2/gamma-2
Name:GABA A receptor alpha-3/beta-2/gamma-2
Synonyms:GABA A Alpha3Beta3Gamma2 | GABA C | GABA receptor alpha-3 subunit | GABA-A receptor | Gamma-aminobutyric acid receptor subunit alpha-3 | agonist GABA site
Type:Enzyme Catalytic Domain
Mol. Mass.:55175.47
Organism:HUMAN
Description:GABA A Alpha3Beta1Gamma2 0 HUMAN::P34903
Residue:492
Sequence:
MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGA
APSASSTPTIIASPKATYVQDSPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26263
NameBDBM26263
Synonyms:Anexate | CHEMBL407 | FLUMAZENIL | Ro15-1788 | Romazicon | [3H]Ro15-1788 | ethyl 12-fluoro-8-methyl-9-oxo-2,4,8-triazatricyclo[8.4.0.0^{2,6}]tetradeca-1(14),3,5,10,12-pentaene-5-carboxylate
TypeSmall organic molecule
Emp. Form.C15H14FN3O3
Mol. Mass.303.2884
SMILESCCOC(=O)c1ncn-2c1CN(C)C(=O)c1cc(F)ccc-21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a