Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM50013515
Substrate/Competitorn/a
Ki 0.04±n/a nM
CommentsPDSP_1590
Citation Murphy, TJBylund, DB Characterization of alpha-2 adrenergic receptors in the OK cell, an opossum kidney cell line. J Pharmacol Exp Ther244:571-8 (1988) [PubMed]
More Info.:Get all data from this article
 
adrenergic Alpha2
Name:adrenergic Alpha2
Synonyms:Alpha-2B adrenergic receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41875.91
Organism:OPOSSUM
Description:adrenergic Alpha2 0 OPOSSUM::O77715
Residue:382
Sequence:
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE
LLGYWYFRHTWCEVYLALDVLFCTSSIVHLCAISLDRYWSVSRALEYNSKRTPRRIKGII
LTVWLIAAFISLPPLIYKGDKGKKPGGRPQCKLNEEAWYILSSSIGSFFAPCLIMILVYL
RIYLIAKRRNRQGPHGKQAPGDGDTGPSALGGTSTISKLPPSILPAVGEANGHSKPPGER
EGGEQMGDPTSPSTPPNQSSVGPEDGSQKQEEEEEEEEEEEEECGPPAPPTSSSLQGTPN
FQPSQGSQVLATLRGQVLLARGPASLGLQPWRRRTQMNREKRFTFVLAVVIGVFVLCWFP
FFFSYSLGAICPQHCKVPHGLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013515
n/a
NameBDBM50013515
Synonyms:(+)-yohimbine | (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylic acid methyl ester | 17alpha-hydroxyyohimban-16alpha-carboxylic acid methyl ester | CHEMBL15245 | CORYNANTHINE | Johimbin | Quebrachin | RAUWOLSCINE | YOHIMBINE CHLORIDE | Yohimbin | Yohimbine | aphrodine | cid_8969 | corynine | methyl 17alpha-hydroxyyohimban-16alpha-carboxylate | quebrachine | yohimbic acid methyl ester
TypeSmall organic molecule
Emp. Form.C21H26N2O3
Mol. Mass.354.4427
SMILESCOC(=O)[C@H]1[C@@H](O)CC[C@H]2CN3CCc4c([nH]c5ccccc45)[C@@H]3C[C@H]12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: