Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin
LigandBDBM18137
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_2560
Citation Van Dijk, ARichards, JGTrzeciak, AGillessen, DMöhler, H Cholecystokinin receptors: biochemical demonstration and autoradiographical localization in rat brain and pancreas using [3H] cholecystokinin8 as radioligand. J Neurosci4:1021-33 (1984) [PubMed]
More Info.:Get all data from this article
 
Cholecystokinin
Name:Cholecystokinin
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:12844.29
Organism:RAT
Description:Cholecystokinin 0 RAT::P01355
Residue:115
Sequence:
MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18137
NameBDBM18137
Synonyms:AMP | CHEMBL752 | [(2R,3S,4R,5R)-5-adenin-9-yl-3,4-dihydroxy-tetrahydrofuran-2-yl]methyl dihydrogen phosphate;hydrate | adenosine 5 -monophosphate | {[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid
TypeNucleoside or nucleotide
Emp. Form.C10H14N5O7P
Mol. Mass.347.2212
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a