Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR7
LigandBDBM82087
Substrate/Competitorn/a
Ki 0.52±n/a nM
CommentsPDSP_172
Citation To, ZPBonhaus, DWEglen, RMJakeman, LB Characterization and distribution of putative 5-ht7 receptors in guinea-pig brain. Br J Pharmacol115:107-16 (1995) [PubMed]  Article
More Info.:Get all data from this article
 
HTR7
Name:HTR7
Synonyms:5-HT7 | 5-HT7L | Serotonin 7 (5-HT7) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:49632.36
Organism:GUINEA PIG
Description:5-HT7 HTR7 GUINEA PIG::P50407
Residue:446
Sequence:
MMGVNSSGRPDLYGHLHSILLPGRGLPDWSPDGGADPGVSTWTPRLLSGVPEVAASPSPS
WDGTWDNVSGCGEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYL
IVSLALADLSVAVAVIPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISID
RYLGITRPLTYPVRQNGKCMPKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGY
TIYSTAVAFYIPMSVMLFMYYRIYKAARKSAAKHKFPGFPRVQPESIISLNGMVKLQKEV
EECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTACS
CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEAL
KLAERPERPECVLQNSDYCRKKGHDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82087
NameBDBM82087
Synonyms:2-(5-methoxy-1H-indol-3-yl)ethanamine | 5-MT | 5-Methoxytryptamine hydrochloride | CAS_66-83-1 | tryptamine, 5-Methoxy
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESCOc1ccc2[nH]cc(CCN)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a