Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT2
LigandBDBM82434
Substrate/Competitorn/a
Ki 0.91±n/a nM
CommentsPDSP_1027
Citation Beauchamp, HTChang, RSSiegl, PKGibson, RE In vivo receptor occupancy of the angiotensin II receptor by nonpeptide antagonists: relationship to in vitro affinities and in vivo pharmacologic potency. J Pharmacol Exp Ther272:612-8 (1995) [PubMed]
More Info.:Get all data from this article
 
Angiotensin II AT2
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41346.62
Organism:RAT
Description:Angiotensin II AT2 0 0::P35351
Residue:363
Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82434
NameBDBM82434
Synonyms:2-Butyl-6-(dimethylamino)-3-[[2-(cyclopropylcarbonylmethylsulfonyl)biphenyl-4'-yl]methyl]quinazolin-4(3H)-one | L-161,865 | L-161865
TypeSmall organic molecule
Emp. Form.C32H35N3O4S
Mol. Mass.557.703
SMILES[#6]-[#6]-[#6]-[#6]-c1nc2ccc(cc2c(=O)n1-[#6]-c1ccc(cc1)-c1ccccc1[S;v6](=O)(=O)[#6]-[#6](=O)-[#6]-1-[#6]-[#6]-1)-[#7](-[#6])-[#6]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a