Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1D
LigandBDBM82087
Substrate/Competitorn/a
Ki 2.18±n/a nM
CommentsPDSP_172
Citation Boess, FGMartin, IL Molecular biology of 5-HT receptors. Neuropharmacology33:275-317 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 1D
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | Serotonin Receptor 1D
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41920.63
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:377
Sequence:
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82087
NameBDBM82087
Synonyms:2-(5-methoxy-1H-indol-3-yl)ethanamine | 5-MT | 5-Methoxytryptamine hydrochloride | CAS_66-83-1 | tryptamine, 5-Methoxy
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESCOc1ccc2[nH]cc(CCN)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a