Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM82531
Substrate/Competitorn/a
Ki 61.2±n/a nM
CommentsPDSP_2571
Citation van Galen, PJvan Bergen, AHGallo-Rodriguez, CMelman, NOlah, MEIJzerman, APStiles, GLJacobson, KA A binding site model and structure-activity relationships for the rat A3 adenosine receptor. Mol Pharmacol45:1101-11 (1994) [PubMed]
More Info.:Get all data from this article
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82531
NameBDBM82531
Synonyms:6-Thiopurine riboside | CAS_1867 | NSC_1867
TypeSmall organic molecule
Emp. Form.C10H12N4O4S
Mol. Mass.284.292
SMILESOCC1OC(C(O)C1O)n1cnc2c1nc[nH]c2=S
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a