Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine/alpha-aminoadipate aminotransferase, mitochondrial
LigandBDBM273070
Substrate/Competitorn/a
Meas. Tech.KAT-II inhibitory assay
pH8±n/a
IC50 16.0±n/a nM
Commentsextracted
Citation Okuyama, MFukunaga, KUsui, KHayashi, NIijima, DHoriuchi, HItagaki, N Bicyclic or tricyclic heterocyclic compound US Patent US10065972 Publication Date 9/4/2018
More Info.:Get all data from this article,  Assay Method
 
Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Name:Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Synonyms:2-aminoadipate aminotransferase | 2-aminoadipate transaminase | AADAT | Alpha-aminoadipate aminotransferase | KAT/AadAT | KAT2 | Kynurenine aminotransferase II | Kynurenine aminotransferase II (KAT II) | Kynurenine--oxoglutarate aminotransferase II | Kynurenine--oxoglutarate transaminase 2 | Kynurenine--oxoglutarate transaminase II
Type:Enzyme
Mol. Mass.:47353.09
Organism:Homo sapiens (Human)
Description:Q8N5Z0
Residue:425
Sequence:
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM273070
NameBDBM273070
Synonyms:(R)-N-benzyl-1-(6-methyl-7-oxo-5-phenyl-6,7-dihydro[1,3]thiazolo[5,4-d]pyrimidin-2-yl)pyrrolidine-2-carboxamide | BDBM273093 | BDBM273119 | BDBM273143 | BDBM273144 | US10065972, Example 178
TypeSmall organic molecule
Emp. Form.C24H23N5O2S
Mol. Mass.445.537
SMILESCn1c(nc2sc(nc2c1=O)N1CCC[C@@H]1C(=O)NCc1ccccc1)-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a