BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase A2
LigandBDBM29684
Substrate/Competitorn/a
Meas. Tech.Dose response counterscreen of uHTS hits for ATG4B inhibitors in a Phospholipase A2 assay
IC50 8310±n/a nM
Citation PubChem, PC Dose response counterscreen of uHTS hits for ATG4B inhibitors in a Phospholipase A2 assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,  Assay Method
 
Phospholipase A2
Name:Phospholipase A2 group 1B
Synonyms:Group IB phospholipase A2 | Phosphatidylcholine 2-acylhydrolase 1B | Phospholipase A2 (PLA2) | phospholipase A2 precursor
Type:Protein
Mol. Mass.:16364.13
Organism:Homo sapiens (Human)
Description:P04054
Residue:148
Sequence:
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29684
NameBDBM29684
Synonyms:(3E)-3-(2-furanylmethylidene)-1,2-dihydrocyclopenta[b]quinoline-9-carboxylic acid [2-[(2-methylcyclohexyl)amino]-2-oxoethyl] ester | (3E)-3-(2-furfurylidene)-1,2-dihydrocyclopenta[b]quinoline-9-carboxylic acid [2-keto-2-[(2-methylcyclohexyl)amino]ethyl] ester | MLS000336228 | SMR000253782 | [2-[(2-methylcyclohexyl)amino]-2-oxidanylidene-ethyl] (3E)-3-(furan-2-ylmethylidene)-1,2-dihydrocyclopenta[b]quinoline-9-carboxylate | [2-[(2-methylcyclohexyl)amino]-2-oxoethyl] (3E)-3-(furan-2-ylmethylidene)-1,2-dihydrocyclopenta[b]quinoline-9-carboxylate | cid_5860596
TypeSmall organic molecule
Emp. Form.C27H28N2O4
Mol. Mass.444.5222
SMILESCC1CCCCC1NC(=O)COC(=O)c1c2CC\C(=C/c3ccco3)c2nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a