BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-9
LigandBDBM18
Substrate/Competitorn/a
Meas. Tech.Dose response confirmation of uHTS hits for Apaf-1 using a LZ-Caspase-9/Caspase-3 Fluorescent Selectivity assay
IC50 7890±n/a nM
Citation PubChem, PC Dose response confirmation of uHTS hits for Apaf-1 using a LZ-Caspase-9/Caspase-3 Fluorescent Selectivity assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,  Assay Method
 
Caspase-9
Name:Apoptotic protease-activating factor 1/Caspase-3/Caspase-9/Cytochrome c
Synonyms:Apoptotic protease-activating factor 3 | CASP-9 | Caspase 9 | ICE-like apoptotic protease 6 | caspase-9 isoform alpha preproprotein
Type:Enzyme
Mol. Mass.:46277.29
Organism:Homo sapiens (human)
Description:n/a
Residue:416
Sequence:
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18
NameBDBM18
Synonyms:(3-amino-5-methyl-6-phenyl-phenanthridin-5-ium-8-yl)amine;bromide | 3,8-diamino-5-methyl-6-phenylphenanthridin-5-ium bromide | 5-methyl-6-phenyl-phenanthridin-5-ium-3,8-diamine;bromide | 5-methyl-6-phenylphenanthridin-5-ium-3,8-diamine;bromide | Dimidium bromide | MLS001074889 | SMR000568409 | cid_68207 | ethidium bromide
TypeSmall organic molecule
Emp. Form.C20H18N3
Mol. Mass.300.3765
SMILESCn1c(-c2ccccc2)c2cc(N)ccc2c2ccc(=[NH2+])cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a