Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuteinizing Hormone-Releasing Hormone LHRH
LigandBDBM84717
Substrate/Competitorn/a
Ki 0.03±n/a nM
CommentsPDSP_79
Citation Haviv, FFitzpatrick, TDSwenson, RENichols, CJMort, NABush, ENDiaz, GBammert, GNguyen, ARhutasel, NS Effect of N-methyl substitution of the peptide bonds in luteinizing hormone-releasing hormone agonists. J Med Chem36:363-9 (1993) [PubMed]  Article
More Info.:Get all data from this article
 
Luteinizing Hormone-Releasing Hormone LHRH
Name:Luteinizing Hormone-Releasing Hormone LHRH
Synonyms:Progonadoliberin-1
Type:Enzyme Catalytic Domain
Mol. Mass.:10497.39
Organism:RAT
Description:Luteinizing Hormone-Releasing Hormone LHRH 0 RAT::P07490
Residue:92
Sequence:
METIPKLMAAVVLLTVCLEGCSSQHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQN
FECTVHWPRSPLRDLRGALERLIEEEAGQKKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84717
NameBDBM84717
Synonyms:nafarelin 7NMeLeu
TypeSmall organic molecule
Emp. Form.C67H85N17O13
Mol. Mass.1336.4979
SMILESCC(C)C[C@H](N(C)C(=O)[C@@H](Cc1ccc2ccccc2c1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H]1CCC(=O)N1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@H]1C(=O)NCC(N)=O |r,wU:42.57,66.71,24.35,75.81,89.97,wD:36.41,56.68,9.22,4.4,(4.31,-3.28,;5.62,-2.47,;6.98,-3.2,;5.58,-.92,;7.27,.05,;7.24,1.6,;8.78,1.6,;5.89,2.38,;4.25,1.42,;5.89,3.78,;7.3,4.67,;8.68,4.11,;8.64,2.57,;9.96,1.77,;11.33,2.51,;12.66,1.72,;14.02,2.47,;14.04,4.01,;12.72,4.83,;11.36,4.07,;10.03,4.87,;4.65,4.7,;3.3,3.93,;3.3,2.31,;1.92,4.76,;1.92,6.36,;3.25,7.09,;4.54,6.36,;5.85,7.07,;5.85,8.62,;7.01,9.29,;4.55,9.38,;3.25,8.62,;.5,3.94,;-.84,4.7,;-.87,6.2,;-2.13,3.93,;-2.1,2.42,;-.79,1.7,;-3.45,4.64,;-4.69,3.8,;-4.62,2.07,;-6.14,4.56,;-6.14,6.66,;-7.38,7.5,;-7.54,9.01,;-9,9.32,;-9.76,8.03,;-11.24,7.72,;-11.7,6.27,;-10.72,5.17,;-9.23,5.47,;-8.74,6.92,;-7.5,3.63,;-8.71,4.41,;-8.64,5.92,;-9.94,3.67,;-9.94,2.17,;-8.64,1.41,;-7.14,1.48,;-6.6,.06,;-7.77,-.88,;-9.04,-.05,;-11.26,4.41,;-12.55,3.67,;-12.53,2.1,;-13.85,4.43,;-14.01,5.87,;-15.44,6.27,;-16.37,5.01,;-17.87,4.96,;-15.32,3.81,;8.64,-.67,;9.96,.12,;8.68,-2.21,;10,-2.98,;11.35,-2.2,;12.39,-3.01,;13.81,-2.21,;15.17,-3.2,;16.48,-2.17,;17.87,-2.85,;16.38,-.62,;10,-4.51,;8.68,-5.3,;11.36,-5.3,;12.78,-4.67,;13.81,-5.86,;13.05,-7.16,;11.52,-6.83,;10.37,-7.86,;10.7,-9.38,;8.9,-7.38,;7.75,-8.42,;6.28,-7.95,;5.95,-6.42,;5.11,-8.96,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a