Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA A receptor alpha-3/beta-2/gamma-2
LigandBDBM26267
Substrate/Competitorn/a
Ki 7.8±n/a nM
CommentsPDSP_1610
Citation Hadingham, KLWingrove, PLe Bourdelles, BPalmer, KJRagan, CIWhiting, PJ Cloning of cDNA sequences encoding human alpha 2 and alpha 3 gamma-aminobutyric acidA receptor subunits and characterization of the benzodiazepine pharmacology of recombinant alpha 1-, alpha 2-, alpha 3-, and alpha 5-containing human gamma-aminobutyric acidA receptors. Mol Pharmacol43:970-5 (1993) [PubMed]  Article
More Info.:Get all data from this article
 
GABA A receptor alpha-3/beta-2/gamma-2
Name:GABA A receptor alpha-3/beta-2/gamma-2
Synonyms:GABA A Alpha3Beta3Gamma2 | GABA C | GABA receptor alpha-3 subunit | GABA-A receptor | Gamma-aminobutyric acid receptor subunit alpha-3 | agonist GABA site
Type:Enzyme Catalytic Domain
Mol. Mass.:55175.47
Organism:HUMAN
Description:GABA A Alpha3Beta1Gamma2 0 HUMAN::P34903
Residue:492
Sequence:
MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGA
APSASSTPTIIASPKATYVQDSPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26267
NameBDBM26267
Synonyms:RO-154513 | Ro15-4513 | [3H]Ro15-4513 | ethyl 12-azido-8-methyl-9-oxo-2,4,8-triazatricyclo[8.4.0.0^{2,6}]tetradeca-1(10),3,5,11,13-pentaene-5-carboxylate
Typeradiolabeled ligand
Emp. Form.C15H14N6O3
Mol. Mass.326.3101
SMILESCCOC(=O)c1ncn-2c1CN(C)C(=O)c1cc(ccc-21)N=[N+]=[N-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a