Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium-transporting ATPase
LigandBDBM50230314
Substrate/Competitorn/a
Meas. Tech.ChEMBL_76079
IC50 0±n/a nM
Citation Weidmann, KHerling, AWLang, HJScheunemann, KHRippel, RNimmesgern, HScholl, TBickel, MMetzger, H 2-[(2-pyridylmethyl)sulfinyl]-1H-thieno[3,4-d]imidazoles. A novel class of gastric H+/K(+)-ATPase inhibitors. J Med Chem35:438-50 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Potassium-transporting ATPase
Name:Potassium-transporting ATPase
Synonyms:Potassium-transporting ATPase | Potassium-transporting ATPase alpha chain 1
Type:Enzyme
Mol. Mass.:114279.23
Organism:Sus scrofa (Pig)
Description:P19156
Residue:1034
Sequence:
MGKAENYELYQVELGPGPSGDMAAKMSKKKAGRGGGKRKEKLENMKKEMEINDHQLSVAE
LEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAI
CLIAFAIQASEGDLTTDDNLYLALALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQAT
VIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILQAQGRKVDNSSLTGESEPQTRSPE
CTHESPLETRNIAFFSTMCLEGTAQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIEH
FVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAKR
LASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHSADTTEDQSGQT
FDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGY
RERFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHVLVMKGAPERVLERCSSILIKGQELPL
DEQWREAFQTAYLSLGGLGERVLGFCQLYLSEKDYPPGYAFDVEAMNFPTSGLSFAGLVS
MIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLRV
PVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLGA
IVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFD
NLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAESD
IMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRPQW
ENHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEMCQIADVLIRKTRRLSAFQQGFF
RNRILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPMPFGLLIFVYDEIRKLGV
RCCPGSWWDQELYY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50230314
NameBDBM50230314
Synonyms:CHEMBL342046
TypeSmall organic molecule
Emp. Form.C12H9F2N3O2S2
Mol. Mass.329.346
SMILES[O-][S+](Cc1ncccc1OC(F)F)c1nc2cscc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a