Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50001463
Substrate/Competitorn/a
Meas. Tech.ChEBML_73269
IC50 102±n/a nM
Citation Schiller, PWWeltrowska, GNguyen, TMWilkes, BCChung, NNLemieux, C Conformationally restricted deltorphin analogues. J Med Chem35:3956-61 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001463
NameBDBM50001463
Synonyms:14-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-2-benzyl-3,8,15-trioxo-1,4,9triaza-cyclopentadecane-5-carboxylic acid {1-[1-(carbamoylmethyl-carbamoyl)-2-methyl-propylcarbamoyl]-2-methyl-propyl}-amide | CHEMBL132164
TypeSmall organic molecule
Emp. Form.C41H59N9O9
Mol. Mass.821.9621
SMILESCC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H]1CCC(=O)NCCCC[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)N[C@@H](Cc2ccccc2)C(=O)N1)C(C)C)C(=O)NCC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a